HORDB

ID: hor006602
Uniprot ID: Q9W4Q9
Protein name: Probable insulin-like peptide 7 A chain
Gene name: Ilp7
Organism: Drosophila melanogaster (Fruit fly)
Family: Insulin family
Source: Animal
Expression: Expressed in the embryo and larva. |Broadly expressed at a low level throughout the embryo, except the yolk. Expressed at a moderate level in the embryonic midgut. Larval expression is restricted to ten cells of the ventral nerve cord - in four pairs of c
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005158 insulin receptor binding
GO BP: GO:0008286 insulin receptor signaling pathway
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: SDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY
Length: 36(124-159)
Propeptide: MTRMIIQNSGSWTLCGAVLLFVLPLIPTPEALQHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY
Signal peptide: MTRMIIQNSGSWTLCGAVLLFVLPLIPTPEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006602_AF2.pdb

hor006602_ESM.pdb

Mass:	473987	Formula:	C170H253N51O61S4
Absent amino acids:	FLMQV	Common amino acids:	CENS
pI:	5.66	Basic residues:	5
Polar residues:	20	Hydrophobic residues:	4
Hydrophobicity:	-131.94	Boman Index:	-11198
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	16.39
Instability Index:	11000.83	Extinction Coefficient cystines:	10220
Absorbance 280nm:	292

PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 11250149
Title: An evolutionarily conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control.